PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G235650.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family FAR1
Protein Properties Length: 731aa    MW: 84511.9 Da    PI: 8.4404
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G235650.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR168.51.6e-21112198391
                  FAR1   3 YneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                           ++ YA++ GF vrk++s++s+ +g+  ++ fvC+++gk+  ++    ++rr+++ ++t+Ck  ++vk+e  g w+vt ++leHnHelap
  Sobic.006G235650.1.p 112 FKIYARKKGFAVRKDASYTSRITGQLERQMFVCNRSGKPICTDGP-GRKRRSNVLENTNCKVLVRVKLE-LGLWVVTAVHLEHNHELAP 198
                           678**************************************9999.9**********************.9***************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.9E-19112198IPR004330FAR1 DNA binding domain
PfamPF105511.3E-29320412IPR018289MULE transposase domain
PROSITE profilePS5096610.695602638IPR007527Zinc finger, SWIM-type
PfamPF044341.3E-4612635IPR007527Zinc finger, SWIM-type
SMARTSM005754.3E-5613640IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    Send to blast
MRSRAYQVAQ NPRTQAAAPG GRRQNTTKIQ EGNTQTQEEL ANETRHPTEP SNTTEDRIID  60
DISEPPAQTT EEREMDNMFE EANYPSMNEI ENAEEPQVGM SFATREDAFY AFKIYARKKG  120
FAVRKDASYT SRITGQLERQ MFVCNRSGKP ICTDGPGRKR RSNVLENTNC KVLVRVKLEL  180
GLWVVTAVHL EHNHELAPST WLVRFMRCHK NMNESEKNFI GVLQNSRVPP RKVMSIFRLL  240
RGHLRCIGFD AKDVSNLQSK ERMQHKHKDI AELLDIFKDR QKTIPGFYYS VMADEDGTVR  300
SIFWTDAIGI ANYKVYGDYM SFDTTFSTNL YGMPFAPIIG VNNHGKTILF GCALLKDQTI  360
STFEWLFDTF LIANNGKMPS SIISDQDQSI ASAIQSKFPT AVRRFCFWHI VKELKRKNVA  420
FFAARPNLYK KLKYAVKNSF TIQEFEMRWN EILDEYQARE NNSINYLYNI RRYWVPAYFM  480
SSFYPFSSTT GRSESTNALF KGYVTHKETI VNFFEAYEQI QEKNLSTLDR CRFNSEIKCP  540
SKWSFNGLEQ HAATLYTTAI FQRVQKEFKS ATAYAVKEIV PEKMFQLRRK TVYDSEFEKE  600
EFEVTVTEDK EHFTCSCRKL DRDGIPCCHV LKIAERLDLL MIPASFVRYR WTKQADQEIV  660
LQVGQELTLK HGNAANSIQY CLMMGEVSDY CSSISGNKRA VELFTAEFHK LKETINSKLT  720
EHQDASGNQN G
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002447195.10.0hypothetical protein SORBIDRAFT_06g030275, partial
TrEMBLC5Y8Y40.0C5Y8Y4_SORBI; Putative uncharacterized protein Sb06g030275 (Fragment)
STRINGSb06g030275.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.16e-90FAR1-related sequence 5